{ document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); clearWarning(pagerId); "truncateBody" : "true", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" } "context" : "", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1280,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAAB1JbBVwGBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVdV1BRVFADBxQBU1AFSQFXBwVIDwQLU08GVFABAlEKU1QFCQtAThUPVn1bVgB\/AhsIQCtZEFBBWlcRGyNXVgUHRQVQR1EQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2049756 .lia-rating-control-passive', '#form_2'); "action" : "rerender" }, } { if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") }, ] "forceSearchRequestParameterForBlurbBuilder" : "false", })(LITHIUM.jQuery); { "action" : "pulsate" ] o.innerHTML = "Page number must be 1 or greater. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" { { "action" : "rerender" "initiatorBinding" : true, } { "displaySubject" : "true", Bist du sicher, dass du fortfahren möchtest? } ] "actions" : [ "event" : "RevokeSolutionAction", "event" : "ProductMessageEdit", }, ], { }, "action" : "rerender" }, { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", disableInput(pagerId); "event" : "deleteMessage", } { "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); //var height = $(window).scrollTop(); "context" : "", "action" : "rerender" { { watching = false; "context" : "", }, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2049467}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2049472}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2049476}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2049756}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2049769}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2050556}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2050586}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2051986}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2052020}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2052024}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513747}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2525974}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540369}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519324}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543713}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543642}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543611}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543588}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543515}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543376}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543372}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543343}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543287}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543269}}]); "action" : "pulsate" { }, { } }, "actions" : [ "context" : "", return false; LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "event" : "MessagesWidgetEditCommentForm", $(document).ready(function(){ { { } }, "actions" : [ { { LITHIUM.Dialog.options['-1092877362'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { ] }, { { }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", })(LITHIUM.jQuery); "context" : "", }, o.innerHTML = "Page must be in a numeric format. "actions" : [ }, ] } ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductAnswerComment", ] { } { "event" : "RevokeSolutionAction", "initiatorBinding" : true, "displaySubject" : "true", { "}); "event" : "approveMessage", "event" : "deleteMessage", }, { { ] var count = 0; }, } "actions" : [ { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } "context" : "envParam:entity", "action" : "rerender" ] } "includeRepliesModerationState" : "false", "context" : "envParam:quiltName", "displayStyle" : "horizontal", "action" : "rerender" { if ( Number(val) < 1 ) "actions" : [ "truncateBodyRetainsHtml" : "false", "action" : "rerender" { "event" : "unapproveMessage", "disallowZeroCount" : "false", ] { { { "showCountOnly" : "false", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'eV0Tch3l2MRt41uM5REMVRuzcm5URul9M65K6Talz9Q. { "eventActions" : [ ] "action" : "rerender" } }, { "action" : "rerender" "displayStyle" : "horizontal", setWarning(pagerId); "actions" : [ { "context" : "", { }, $(document).keydown(function(e) { ] }, "action" : "rerender" "componentId" : "forums.widget.message-view", "action" : "pulsate" ], { { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); setWarning(pagerId); { "action" : "rerender" function clearWarning(pagerId) { "action" : "addClassName" "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "actions" : [ } "event" : "unapproveMessage", "event" : "addMessageUserEmailSubscription", "actions" : [ } "action" : "pulsate" } $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { "disableKudosForAnonUser" : "false", "action" : "pulsate" ;(function($) { count = 0; "event" : "expandMessage", "action" : "rerender" }); "actions" : [ ] { "selector" : "#kudosButtonV2_2", "selector" : "#kudosButtonV2_8", "action" : "rerender" "action" : "rerender" "disableLinks" : "false", "context" : "", }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "componentId" : "kudos.widget.button", }, "event" : "MessagesWidgetEditAction", } } "actions" : [ "actions" : [ "dialogKey" : "dialogKey" "actions" : [ "truncateBodyRetainsHtml" : "false", } element.siblings('li').find('li').removeClass('active'); "event" : "RevokeSolutionAction", clearWarning(pagerId); "event" : "QuickReply", "event" : "ProductAnswerComment", "context" : "", "context" : "", "actions" : [ "context" : "", } { watching = false; if (1 != val) if(1 < 4){ { } } "action" : "rerender" if (doChecks(pagerId, val)) document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "kudosLinksDisabled" : "false", } }); }, watching = false; ] "actions" : [ Bist du sicher, dass du fortfahren möchtest? "disableLabelLinks" : "false", { { }, }, "actions" : [ } "action" : "rerender" LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:selectedMessage", ] "context" : "envParam:quiltName", }, ], { "event" : "MessagesWidgetCommentForm", { { { "action" : "rerender" }, ] } "event" : "addMessageUserEmailSubscription", ] "actions" : [ { }, "context" : "envParam:quiltName,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", clearWarning(pagerId); ] "actions" : [ "action" : "rerender" }, "actions" : [ { "context" : "", }, Na prémiovém… Kabelová síť Vodafone (dříve UPC) je druhá největší přístupová síť v ČR. "messageViewOptions" : "1111110111111111111110111110100101001101" { ], { "event" : "removeMessageUserEmailSubscription", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:feedbackData", LITHIUM.Dialog.options['-914970954'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Unitymedia). "action" : "rerender" "displayStyle" : "horizontal", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", "event" : "AcceptSolutionAction", } { } } }, ;(function($) { function doChecks(pagerId, val) { "disableKudosForAnonUser" : "false", "event" : "kudoEntity", It would be perfect. { { { LITHIUM.Dialog({ "action" : "rerender" { "kudosable" : "true", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'kvDhNm_b_q9H5V_UTTIVSegqqhi_W5G_OjuNP3PLGz0. { ] }, "action" : "rerender" Internet service providers (ISPs) often provide a modem and router combo device, also known as a gateway router. "initiatorBinding" : true, }, "context" : "envParam:quiltName,message", { "displaySubject" : "true", "eventActions" : [ "selector" : "#messageview_7", "event" : "AcceptSolutionAction", } ] "; "event" : "MessagesWidgetMessageEdit", { "quiltName" : "ForumMessage", watching = false; } "actions" : [ "displaySubject" : "true", { "context" : "envParam:entity", "event" : "addMessageUserEmailSubscription", }, "action" : "addClassName" }, $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "actions" : [ }, }, { } } } { if (doChecks(pagerId, val)) "action" : "rerender" "actions" : [ } }, { "event" : "unapproveMessage", }, "actions" : [ "actions" : [ ] { "actions" : [ }, "action" : "rerender" // Set start to true only if the first key in the sequence is pressed }, "action" : "rerender" return true; "event" : "markAsSpamWithoutRedirect", } "action" : "rerender" "initiatorBinding" : true, "event" : "removeThreadUserEmailSubscription", "actions" : [ "action" : "rerender" function setWarning(pagerId) { ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" { { ], { "action" : "rerender" }, { "event" : "ProductMessageEdit", "context" : "envParam:entity", { "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "event" : "MessagesWidgetMessageEdit", "context" : "", } > 0) ) ] ] "action" : "rerender" "action" : "rerender" "event" : "editProductMessage", } })(LITHIUM.jQuery); "useTruncatedSubject" : "true", } Hier findest Du unsere Download-Dokumente auf einen Blick. { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", { "dialogKey" : "dialogKey" } ] LITHIUM.Dialog.options['1757288306'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "}); ] } { }, window.onload = function() { "event" : "markAsSpamWithoutRedirect", "event" : "MessagesWidgetEditAction", "linkDisabled" : "false" "event" : "MessagesWidgetEditAnswerForm", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'Ok_GTL5m-qjBfaMFsMhhnlonKjyV03NoHoNiqEKHI1c. "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "actions" : [ { } "disallowZeroCount" : "false", "linkDisabled" : "false" "actions" : [ "disableKudosForAnonUser" : "false", "event" : "expandMessage", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", "action" : "rerender" }, "event" : "ProductAnswer", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "useSimpleView" : "false", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ }, }, ] setWarning(pagerId); { "disallowZeroCount" : "false", "action" : "rerender" "actions" : [ ], { "eventActions" : [ { "action" : "rerender" "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" { "quiltName" : "ForumMessage", ] "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", } "action" : "rerender" ', 'ajax'); "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ clearWarning(pagerId); { }, "includeRepliesModerationState" : "false", "actions" : [ { "displaySubject" : "true", { "selector" : "#kudosButtonV2_7", } "dialogKey" : "dialogKey" "action" : "rerender" LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, function clearWarning(pagerId) { "actions" : [ { "action" : "rerender" "context" : "envParam:entity", "event" : "MessagesWidgetEditAnswerForm", ] }, } LITHIUM.AjaxSupport.ComponentEvents.set({ "useTruncatedSubject" : "true", "context" : "envParam:quiltName", "actions" : [ ] } }, { "action" : "addClassName" ] "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "action" : "pulsate" "context" : "lia-deleted-state", return false; ], "action" : "rerender" "actions" : [ "actions" : [ ] "action" : "rerender" "context" : "", "actions" : [ $(document).ready(function(){ // console.log(key); "event" : "approveMessage", { ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2052024,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", }, { }, "event" : "QuickReply", "actions" : [ "quiltName" : "ForumMessage", "context" : "envParam:selectedMessage",